PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G32380.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 445aa    MW: 48650.4 Da    PI: 6.7561
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G32380.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.35.4e-16110156148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT +Ede l++ v ++G + W++Ia+ ++  R +kqc++rw ++l
  LPERR01G32380.1 110 KGAWTRQEDEVLKQMVILHGDRKWAAIAKSLP-DRIGKQCRERWTNHL 156
                      79******************************.************996 PP

2Myb_DNA-binding54.82.2e-17162204145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ WT+e+d  l++a+k +G++ W++Iar+++ gR+++ +k++w+
  LPERR01G32380.1 162 KDVWTEEDDRVLIEAHKAYGNR-WSAIARCIP-GRSENAVKNHWN 204
                      578*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.016105160IPR017930Myb domain
SuperFamilySSF466894.31E-29108203IPR009057Homeodomain-like
SMARTSM007172.0E-15109158IPR001005SANT/Myb domain
PfamPF002497.1E-15110156IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-24111162IPR009057Homeodomain-like
CDDcd001672.60E-14112156No hitNo description
PROSITE profilePS5129418.449161211IPR017930Myb domain
SMARTSM007174.4E-17161209IPR001005SANT/Myb domain
PfamPF002498.4E-15162204IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-20163208IPR009057Homeodomain-like
CDDcd001677.02E-14165207No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 445 aa     Download sequence    Send to blast
MAAAGNSFLH QDPAMIGGRM PDRYFASSSH GTGAHYQSTG GAPITVAAPD MGFLVAGIGM  60
TPSRLVMPEG ALAAGYGAMP TISVGVAMQQ QQQQQQSRVG GNNRNPGPFK GAWTRQEDEV  120
LKQMVILHGD RKWAAIAKSL PDRIGKQCRE RWTNHLRPDI KKDVWTEEDD RVLIEAHKAY  180
GNRWSAIARC IPGRSENAVK NHWNATKRSL KSKRKMKKRS EQLMPRQLSQ LEEYIRTQCP  240
TASEETTPSP PVSAPPSEDV VMYDAGSVNT GPIAAVQEPT DSNDVGLANP PEIGIYLGLA  300
NPAGSPQQIG AMNLNMSLAP DHNAYDEQRN EYYQLPFVHQ GNLHYGQHEQ AQPVQQQGIS  360
VDQDFQPSYL SLYHPSYPGS HVGRVEFHFQ STNLQANVGG YYSEAGPSST AGAGAGDPED  420
VIQMASRQFL MPSEAEVTLD LTKFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-401062063103B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645142.10.0PREDICTED: uncharacterized protein LOC4324828
TrEMBLA0A0D9V7Y10.0A0A0D9V7Y1_9ORYZ; Uncharacterized protein
STRINGLOC_Os01g63680.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27785.15e-43myb domain protein 118